SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008531 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008531
Domain Number 1 Region: 375-500
Classification Level Classification E-value
Superfamily EF-hand 7.25e-45
Family EF-hand modules in multidomain proteins 0.0000092
Further Details:      
 
Domain Number 2 Region: 503-597
Classification Level Classification E-value
Superfamily EF-hand 1.45e-34
Family EF-hand modules in multidomain proteins 0.0000355
Further Details:      
 
Domain Number 3 Region: 579-665
Classification Level Classification E-value
Superfamily RING/U-box 8.24e-18
Family ZZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 213-334
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000222
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 5 Region: 337-374
Classification Level Classification E-value
Superfamily WW domain 0.0000000000114
Family WW domain 0.00021
Further Details:      
 
Domain Number 6 Region: 76-143
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000648
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008531   Gene: ENSCJAG00000004685   Transcript: ENSCJAT00000009023
Sequence length 952
Comment pep:novel chromosome:C_jacchus3.2.1:X:90484813:90515555:1 gene:ENSCJAG00000004685 transcript:ENSCJAT00000009023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMQGCPYTLPRCHDWQAADQFRHSSSLRTTCPQPQVRAAVTSPAPPQDGAGVPCLRLKL
LNGSVGASGPLEPPAMNLCWNEIKKKSHNLRARLEAFSDHSGKLQLPLQEIIDWLSQKDE
ELSAQLPLQGDVALVQQEKETHAVDVNVLKSLTMEKYVFVCIWADPVWLAQPGFLPLPAD
TSPKQRIQNLSRFVWKQATVASELWEKLTARCVDQHRHIERTLEQLLEIQAAMEELSTTL
TQAEGVRATWEPIGDLFIDSLPEHIQALKLFKEEFSPMKDGVKLVNDLAHQLAISDVHLS
MENSQALEQINVRWKQLQASVSERLKQLQDAHRDFGPGSQHFLSSSVQVPWERAISPNKV
PYYINHQAQTTCWDHPKMTELYQTLADLNNIKFSAYRTAMKLRRVQKALRLDLVTLTTAL
EIFSEHDLQASEHVMDVVEVIHCLTALYERLEEERGILVNVPLCVDMSLNWLLNVFDRPS
GRSGKMRALSFKTGIACLCGTEVKEKLQYLFSQVANSGSQCDQRHLGVLLHEAIQVPRQL
GEVAAFGGSNVEPSVRSCFRFSTGKPVIEASQFLEWVNLEPQSMVWLAVLHRVTIAEQVK
HQTKCSICRQCPIKGFRYRSLKQFNVDICQTCFLTGRASKGNKLHYPIMEYYTPTTSSEN
MRDFATTLKNKFRSKHYFSKHPQRGYLPVQSVLEADYSETPASSPMLPHADTHSRIEHFA
SRLAEMESQNCSFFNDSLSPDDSIDEDQYLLRHSSPITDREPAFGQQASCSVATESKGEL
EKILAHLEDENRILQGELRRLKWQHEEATEAPTLAEGSAEAAPDHRNEELLAEARILRQH
KSHLETRMQILEDHNKQLESQLQRLRELLLQPPTESDGSGSAGSSLASSPQQSEGSHPRE
KGQTTPDTEAADDVGSKSQDVSLCLEDIMEKLRHAFPSVRSSDVTANTLLAS
Download sequence
Identical sequences F7HWI5
ENSCJAP00000008531 ENSCJAP00000008531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]