SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008765 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008765
Domain Number 1 Region: 541-625
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 3.14e-36
Family Kix domain of CBP (creb binding protein) 0.00000655
Further Details:      
 
Domain Number 2 Region: 1013-1135
Classification Level Classification E-value
Superfamily Bromodomain 8.24e-35
Family Bromodomain 0.0000006
Further Details:      
 
Domain Number 3 Region: 300-395
Classification Level Classification E-value
Superfamily TAZ domain 7.46e-29
Family TAZ domain 0.000000927
Further Details:      
 
Domain Number 4 Region: 2017-2072
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 7.45e-25
Family Nuclear receptor coactivator interlocking domain 0.00026
Further Details:      
 
Domain Number 5 Region: 1701-1786
Classification Level Classification E-value
Superfamily TAZ domain 1.7e-24
Family TAZ domain 0.0000024
Further Details:      
 
Domain Number 6 Region: 1637-1683
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000033
Family ZZ domain 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000008765
Domain Number - Region: 400-438
Classification Level Classification E-value
Superfamily PSTPO5379-like 0.0968
Family PSTPO5379-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008765   Gene: ENSCJAG00000004770   Transcript: ENSCJAT00000009266
Sequence length 2387
Comment pep:novel chromosome:C_jacchus3.2.1:1:201840799:201862810:1 gene:ENSCJAG00000004770 transcript:ENSCJAT00000009266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
INQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQNSPGLGLINS
MVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAA
GNXKPKHGKCCNLLTEPLQGSPQMGGQNRLRSPQPLKVGMMNNPNPYGSPYTQNPGQQIG
ASGLGLQIQTKTVLSNNLPPFAMDKKTVPGGGMSSMGQQPASQVQQPGLVTPVAQGMGSG
AHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGK
SCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVG
QQSTPNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQSGQSPQGMRPM
SNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASVASLGPMPTAAQPSTTG
IRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNR
AEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAGGMVPVSMNPGPNMGQPQPGMTSNG
PLPDPTMIRGSVPNQMIPRITSQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGTLN
PPMGYGPRMQQPSSQSQFLPQTQFPSQGMNVTNMSLAPSSGQAPVSQAQMSSSSCPVNSP
IMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATAIPAPVPTP
PAIPSGPQSQALHPPPRQTPTPPTQLTPQVQSSLPAAPSADQSQQQPRSQQSTAASVPTP
TAPLLPPQPATPLSQLAVNTEGQVSNPPSTSSTEVNSQAIPEKQPSQEVKMEAKMEVDQP
EPADTQPEDITESKVDDCKVEPTETEERGTDSKTEIKEEEDQPSTSATQSSPAPGQSKKK
RVFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKL
DTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGR
KLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTI
NKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKEN
KFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDS
GEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRP
KCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEW
YKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEE
RKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYA
TMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRR
AQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKME
KLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQ
HTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQ
MLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPSSMPPY
LPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQ
IFQRPIQHQMPPMAPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWAQGGLPQPQQL
QSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPLKPGTVSQQALQNLLRTLRSPSSPLQ
QQQVLSILHANPQLLAAFIKQRAAKYANSNPQSLPGQPGMPQGQPGLQPPTMPGQQAVHS
NPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNAMPSQFRDILRRQ
QMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPHMQQMQQGNIGQMGQLPQALGAEAG
PREQRPGASLRGLSAGSLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQV
RSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASP
EQNSMLSQLTSNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH
Download sequence
Identical sequences F7IS08
ENSCJAP00000008765 ENSCJAP00000008779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]