SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008903 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008903
Domain Number 1 Region: 214-342
Classification Level Classification E-value
Superfamily PX domain 1.44e-25
Family PX domain 0.0016
Further Details:      
 
Domain Number 2 Region: 5-77
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000131
Family SH3-domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000008903
Domain Number - Region: 372-571
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0167
Family BAR domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008903   Gene: ENSCJAG00000004860   Transcript: ENSCJAT00000009408
Sequence length 573
Comment pep:known chromosome:C_jacchus3.2.1:10:17898684:17907573:1 gene:ENSCJAG00000004860 transcript:ENSCJAT00000009408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKGRALYDFHSENKEEISIQQDEDLVIFSETSLDGWLQGQNSRGETGLFPASYVEIVR
SGISTNHADYSSSPAGSPGTQVSLYNSNTVASPARSGGGSGFLSNQGSFEEDDDDDWDDW
DDGCTVVEEPRAGGLGTNGHPPLNLSYPGAYPSQHMAFRPKPPLERQDSLASAKRGSVVG
RNLNRFSCFVRSGVEAFILGDVPIMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQ
TKFKGIKSYISYKLTPTHAASPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEE
DFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRARRMRWWVPASCS
LPDPHGAPGLQDVEDRVDAFKAFSKKMDDSVLQLSTVASELVRKHVGGFRKEFQKLGSAF
QAISYSFQMDPPFCSEALNSAISHTGRTYEAIGEMFAEQPKNDLFQMLDTLSLYQGLLSN
FPDIIHLQKGAFAKVKESQRMSDEGRMAQDEADGIRRRCRVVGFALQAEMNHFHQRRELD
FKHMMQSYLRQQILFYQRVGQQLEKTLRMYDNL
Download sequence
Identical sequences F7I5R3
ENSCJAP00000008903 ENSCJAP00000008912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]