SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009010 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009010
Domain Number 1 Region: 9-235
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.28e-57
Family DBL homology domain (DH-domain) 0.0000175
Further Details:      
 
Domain Number 2 Region: 221-362
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-34
Family Pleckstrin-homology domain (PH domain) 0.00067
Further Details:      
 
Domain Number 3 Region: 382-492
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-28
Family DEP domain 0.0029
Further Details:      
 
Domain Number 4 Region: 477-606
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.3e-28
Family DEP domain 0.0011
Further Details:      
 
Domain Number 5 Region: 677-743
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000434
Family PDZ domain 0.017
Further Details:      
 
Domain Number 6 Region: 581-672
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000802
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009010   Gene: ENSCJAG00000004877   Transcript: ENSCJAT00000009520
Sequence length 1606
Comment pep:novel chromosome:C_jacchus3.2.1:16:20344286:20454123:1 gene:ENSCJAG00000004877 transcript:ENSCJAT00000009520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEDSRGDCRAESAKELEKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAASK
VDKNVTEETVKMLFSNIEDILAVHKEFLKVVEECLYPEPNAQQEVGICFLHFKDKFRIYD
EYCSNHEKAQKLLLELNKIRTIRAFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLIL
KELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNIT
DTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGHRYLFRGRI
NTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEWFEAILKER
ERRKGLKLGMEQDTWVMISEQGEKLYKMMCRQGNLIKDRKRKLTTFPKCFLGSEFVSWLL
EIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPRNEMQDVIS
KGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLC
DNGFMHHVLEKSEFKDEPLLFRFFSDEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNE
GSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCL
NSRKPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCII
KVNGINVSKETHASVIAHVTACRKYRRPMKQDSIQWVYNSIESAQEDLQKSHSKPPGDEA
GDAFDCKVEEVIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYEYDSTAGIKCNVVEKMI
EPKGFFSLTAKILEALAKSDEHFIQNCISLNSLNEVIPTDLQSKFSALCSERIEHIRQRI
SSYKKFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHVNVMEVSYPKTSTSLGSAFGV
QLDSRKHNSHDKENKSSEQGKLSPMVYIQHTITTMAAPSGLSLGQQDGHGLRYLLKEEDL
ETQDIYQKLLGKLQAALKEMEMCVCQIDDLLSSITYSPKLERKTSECIIPTDSDNEKGER
NSKRVCFNVAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSQCSSYFHSDEMDS
GDELPLSVRISHDKQDKIHSCLEHLFSQVDSITNLLKGQAVVRAFDQTKYLTPGRGLQEF
QQEMEPKLSCPKRLRLHIKQDPWNLPSSVRTLAQNIRKFVEEVKCRILLALLEYSDSETQ
LRRDMVFCQTLVATVCAFSEQLMAALNQMFDNSKENEMETWEASRRWLDQIANAGVLFHF
QSLLSPNLTDEQAMLEDTLVALFDLEKVSFYFKPSEEEPLVANVPLTYQAEGSRQALKVY
FYIDSYHFEQLPERLKNGGGFKIHPVLFAQALESMEGYYYRDSVSVEEFQAQINAASLEK
VKQYNQKLRAFYLDKSNSPPNSTSKAAYVDKLMRPLNALDELYRLVASFIRSKRTAACAN
TACSASGVGLLSVSSELCSRLGACHIIMCSSGVHRCTLSVTLEQAIILARSHGLPPRYIM
QATDVMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCEPPPPAGEE
Download sequence
Identical sequences F7I6F3
ENSCJAP00000009010 ENSCJAP00000009052 XP_002759017.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]