SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009168 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009168
Domain Number 1 Region: 171-477
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-89
Family Protein kinases, catalytic subunit 0.000000188
Further Details:      
 
Domain Number 2 Region: 28-145
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.71e-34
Family cAMP-binding domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009168   Gene: ENSCJAG00000005021   Transcript: ENSCJAT00000009690
Sequence length 488
Comment pep:known chromosome:C_jacchus3.2.1:12:71873445:72435875:-1 gene:ENSCJAG00000005021 transcript:ENSCJAT00000009690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYE
NGEYIIRQGARGDTFFIISKGTVNVTREDSPNEDPVFLRTLGKGDWFGEKALQGEDVRTA
NVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDFNII
DTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVR
LYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYR
DLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWS
LGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERL
GNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDD
NSGWDIDF
Download sequence
Identical sequences F7IMU1
ENSCJAP00000009168 ENSCJAP00000009168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]