SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009201 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009201
Domain Number 1 Region: 128-213
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.93e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009201   Gene: ENSCJAG00000005011   Transcript: ENSCJAT00000009727
Sequence length 298
Comment pep:novel chromosome:C_jacchus3.2.1:5:75016471:75020892:1 gene:ENSCJAG00000005011 transcript:ENSCJAT00000009727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTESGASPEDPWVKASPVGAHAGEGRVGRACARGGAGRRGASLLSPKSPMLSLPRGCREV
NSHPACAKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQE
AYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKT
IDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFN
VFQGIMDSLFQSFNASISVTSFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY
Download sequence
Identical sequences F7IB12
XP_008994892.1.60252 ENSCJAP00000009223 ENSCJAP00000009201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]