SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009505 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009505
Domain Number 1 Region: 132-201
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.44e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009505   Gene: ENSCJAG00000005199   Transcript: ENSCJAT00000010046
Sequence length 346
Comment pep:known chromosome:C_jacchus3.2.1:8:84804738:84891288:-1 gene:ENSCJAG00000005199 transcript:ENSCJAT00000010046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDHQIIPTLKRSQPAVPSGGPLVQHAHTALDSDAGITENPLTKLLTLGKEDDNAQWHM
EDVIEDIIDMESSFKEEGTDSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSLP
MKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTI
LKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQELEIQARTHGLPTLASLGTV
DLGAHVTKQQSHPEQNSVDYCQQLTVSQGPNPELCDQAIAFSDPLSYFTDLSFSAALKEE
QRLDGMLLDDTISPFGTDPLLSATSPAVSKESSRRSSLSSDDGDEL
Download sequence
Identical sequences F7DMG3
XP_002751809.1.60252 XP_009000979.1.60252 XP_009000980.1.60252 ENSCJAP00000009505 ENSCJAP00000009505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]