SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009931 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009931
Domain Number 1 Region: 193-269
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.27e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009931   Gene: ENSCJAG00000005396   Transcript: ENSCJAT00000010493
Sequence length 311
Comment pep:novel chromosome:C_jacchus3.2.1:18:14553346:14559753:-1 gene:ENSCJAG00000005396 transcript:ENSCJAT00000010493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INRQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVL
FGVGIEXLKGQLGLPRLRALCHQCYPATQSMTPAVIQGAFTSDDAVDTEGTAAETHYTYF
PSTAVGDGAGGTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIA
PRTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQS
KGGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHH
GLEVVIKNDSN
Download sequence
Identical sequences F7HHJ4
ENSCJAP00000009931 ENSCJAP00000009902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]