SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010483 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000010483
Domain Number - Region: 112-158
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000797
Family Motor proteins 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010483   Gene: ENSCJAG00000032309   Transcript: ENSCJAT00000011080
Sequence length 200
Comment pep:novel chromosome:C_jacchus3.2.1:15:27630220:27634818:-1 gene:ENSCJAG00000032309 transcript:ENSCJAT00000011080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKQPPKTKEPSKRDEPQQKETPTPLSLGAKSKAEAKTPALVEMQTVDNASEKLEKPPE
TQKKLSDKDMVAIKIQAWWRGTLVHQSPSACIIQCWWRLMLSKILEKRRRAVLEVFSQEE
WAAVTLQSQARMWRIRRHYCQVLNAVCIIQAYWRCRACASQGFIKGQYRVTANQLHLELE
ILLRSGPCIVTECIPISIKE
Download sequence
Identical sequences F7ISD1
ENSCJAP00000010483 ENSCJAP00000010483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]