SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010600 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010600
Domain Number 1 Region: 75-132
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.66e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010600   Gene: ENSCJAG00000012807   Transcript: ENSCJAT00000011199
Sequence length 133
Comment pep:known chromosome:C_jacchus3.2.1:7:151920676:151923579:-1 gene:ENSCJAG00000012807 transcript:ENSCJAT00000011199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLSPDQAADSDHPSSAHSDPESLGGADAKVLGSVSDEPVEEAEGDKGGSRVALYPHPQQ
LSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLA
ICYISYLNHVLDV
Download sequence
Identical sequences F7I1D3
ENSCJAP00000010600 ENSCJAP00000010600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]