SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010830 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010830
Domain Number 1 Region: 90-155
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.36e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010830   Gene: ENSCJAG00000005899   Transcript: ENSCJAT00000011439
Sequence length 243
Comment pep:known chromosome:C_jacchus3.2.1:2:32349271:32350985:-1 gene:ENSCJAG00000005899 transcript:ENSCJAT00000011439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAPLETCISDLDCASSSSSDLSGFLTDEEDCARLQPPASASGPPAPVRRGAPSTSRASE
VPVAQDEEQERRRRRGRARVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLP
SFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGSGARERLLSPQCVPCLPGPPSPA
SDAESWGSGAAASPSAAAASPLSDPSSPAASEDFTYGPGDPIFSFPGLPKDLLHTTPCFI
PYH
Download sequence
Identical sequences F7HYV8
ENSCJAP00000010830 ENSCJAP00000010830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]