SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010985 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010985
Domain Number 1 Region: 2178-2476
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.55e-97
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000434
Further Details:      
 
Domain Number 2 Region: 666-774
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-33
Family Second domain of FERM 0.00021
Further Details:      
 
Domain Number 3 Region: 1075-1184
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-27
Family PDZ domain 0.007
Further Details:      
 
Domain Number 4 Region: 776-882
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-27
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 5 Region: 1351-1464
Classification Level Classification E-value
Superfamily PDZ domain-like 1.1e-24
Family PDZ domain 0.0000158
Further Details:      
 
Domain Number 6 Region: 1789-1878
Classification Level Classification E-value
Superfamily PDZ domain-like 9.86e-22
Family PDZ domain 0.015
Further Details:      
 
Domain Number 7 Region: 1496-1600
Classification Level Classification E-value
Superfamily PDZ domain-like 1.28e-20
Family PDZ domain 0.028
Further Details:      
 
Domain Number 8 Region: 1881-1971
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-17
Family PDZ domain 0.039
Further Details:      
 
Domain Number 9 Region: 572-665
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.86e-17
Family First domain of FERM 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010985   Gene: ENSCJAG00000005723   Transcript: ENSCJAT00000011598
Sequence length 2491
Comment pep:novel chromosome:C_jacchus3.2.1:3:107274599:107418224:-1 gene:ENSCJAG00000005723 transcript:ENSCJAT00000011598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLP
SGSVSFTDENISNQDLPSIXXXXXXXXXXXTSLSDVEKIHIYSLGMTLYWGADHEVPPSQ
PIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGTDQLSCNSEQKPDRSQAIRDRLRGKGLPTGRSSTSDVLDMQKAPLSHPTFLNKGLSKS
MGFLSIRDSQDEEDYFKDMLSDNSGHEDSENTCSPYQFKTSGPEKKAIPGIDVLSKKKSW
ASSMDLLCTTDRDFSSGETGIYRHCHPEAVTVRTSTTPRKKKARYSDGSIALDIFGPQKM
DPTYHTRELPTSSAISSALDRIRERQKKLQVLREAMNVEEPVRRYKTYHSDVFSTPSESP
SVISSESDFRQVRRSEASKRFESSSGLPGVDETPSQGHSQKPSRQYETPFEGNLINQEIM
LKRQEEELMQLQAKMALRQSRLSLYPGDTIKASMLDITRDSLREIALETAMTQRKLRNFF
GPEFVKMTIEPFISLDLPRSILTKKGKNEDNRRKVNIMLLNGQRLELTCDTKTICKDVFD
MVVAHIGLVEHHLFALATLKDNEYFFVDPDLKLTKVAPEGWKEEPKKKTKATVNFTLFFR
IKFFMDDVSLIQHTLTCHQHYLQLRKDILEERMHCDDETSLLLASLALQAEYGDYQPEVH
GVSYFRMEHYLPARVIEKLDLSYIKEELPKLHNTYVGASEKETELEFLKVCQRLTEYGVH
FHRVHPEKKSQTGILLGVCSKGVLVFEVHNGVRTLVLRFPWRETKKISFSKKKITLQNTS
DGIKHAFQTDNSKVCQYLLHLCSSQHKFQLQMRARQSNQDAQDIERASFRSLNLQAESVR
GFNMGRAISTGSLASSTLNKLAVRPLSVQAEILKRLSCSELSLYQPLQNSSKEKNDKASW
EEKPREMSKSYHDLSQASLYPHRKNVIVNMEPPPQTGAELVGKPSDQMARSDAESLAGVT
KLNNSKSVASLNRSPERRKYESDSSIEDPGQAYVLGMTMHSSGNSSFQVPLKENDMQHKR
WSLVSSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLDLGIFISSITPGGPADLDGCLKP
GDRLISVNSVSLEGVSHHTAIEILQNAPEDVTLVISQPKEKTPKVPSTPVHLTNGMKNYM
KKSSYMQDGAIDSSSKDHHWSRGTLKHISENSFGLSGGLREGSLSSQDSRTESASLSQSQ
ANGFFASHLGDQTWQESQHGSPSPSVVSKATEKKTSTDSNQSKTKKPGISDATDYLDHGD
SDMDEATYSSSQDHQTPKKESSSSVNTSNKMNFKTFSSSPPKPGDIFEVELAKTDNSLGI
SVTVLFDKGGVNTSVRHGGIYVKAVIPKGAAESDGRIHKGDRVLAVNGVSLEGATHKQAV
ETLRNTGQVVHLLLEKGQSPTSKEHVPVTPQCTLSDQNSQGQGPEKVKKTTHVKDYSFVT
EENTFEVKLLKNSSGLGFSFSREDNLIPEQINASIVRVKKLFPGQPAAESGKIDVGDVIL
KVNGASLKGLSQQEVVSALRGTAPEVFLLLCRPPPGVLPEIDTALLTPLQSPAQAFPNSS
KDSSQPSCVEQSTSSDENEMSDKSKKQCKSPSRRDSYSDSTGSGEDDLVTAPANIPNSTW
SSALHQTLSNMVSQAQSHHEAPKSQEDTICTMFYYPQKIPQKTEFEDSNPSSPLPLDMAP
GQNCQPQSESASSNLMDKYHTHHISEPARQESWTSLKNDLENHLEDFDLEVELLITLIKS
EKGSLGFTVTKGNQRIGCYVHDVIQDPAKSDGRLKPGDRLIKVNDTDVTNMTHTDAVNLL
RAASKTVRLVIGRLLELPRIPILPHLLPDITLTCNKEELGFSLSGGHDSLYQVVYISDIN
PRSVAAVEGNLQLLDVIHYVNGVSTQGMTLEEVNRALDMSLPSVVLKATRNDLPVVPSSK
RFAVSAPKPTKGNGSYNVDSCSQPALTPSDSFSMVDGEEISEILYPEGKYSTYQTKESPN
LTLSKESYIKEDDIYDDPQEAEVIQSLLDVVDEEAQNLLNQNNATGNSYVPGTLKMNGKL
SEERTEDTDCDGSPLPEDFTEPAKMNGCEEYCEEKIKSESLIQKSQEQKTDDDEVTCGCD
ELPIERANHEDSDKDHSFLTNEELAALPVVKVLPSGKYTGANLKSVIRILRGLLDQGIPS
KELENLQELKPLDQCLIGQTKENRKKNRYKNILPYDATRVPLGDEGGYINASFVKIPVGK
EEFVYIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPNILGKTTMVS
NRLRLALVRMQQLKGFVVRAMTLEDIQTREMRHISHLNFTAWPDHDTPSQPDDLLTFISY
MRHIHKSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTE
DQYIFCYQVILYVLTRLQAEEEQKQQPQLLK
Download sequence
Identical sequences F7IN29
ENSCJAP00000010985 ENSCJAP00000011015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]