SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011055 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011055
Domain Number 1 Region: 570-757
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-46
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 2 Region: 300-475,505-566
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-43
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011055   Gene: ENSCJAG00000005995   Transcript: ENSCJAT00000011670
Sequence length 1094
Comment pep:known chromosome:C_jacchus3.2.1:6:56270795:56443433:1 gene:ENSCJAG00000005995 transcript:ENSCJAT00000011670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSTFICNTHIIPVKNQEGVAMMFIINFEYVTDDENATSPQRVNPILPVKTVNRKFFGFKF
PALRVLTYRKQSLPQEDPDVVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQP
SKCSPLVNISGPLDHSSPKRQWDRLYPDMLQSSSQLSHSRSRESLCSIRRASSVHDIEGF
SVHPKNIFRDRHASEDNGRNVKGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSDV
KTEKKNSSPPSSDKTIIAPKVKDRTHNVTEKVTQVLSLGADVLPEYKLQTPRINKFTILH
YSPFKAVWDWLILLLVIYTAIFTPYSAAFLLNDREEQKRRECGYSCSPLNVVDLIVDIMF
IIDILINFRTTYVNQNEEVVSDPAKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTL
IGLLKTARLLRLVRVARKLDRYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYLT
DKIGWLDSLGQQIGKRYNDSDSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKI
FSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEE
YFQHAWTYTNGIDMNMVLKGFPECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKFK
TTHAPPGDTLVHCGDVLTALYFLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKSN
ADVRALTYCDLHKIQREDLLEVLDMYPEFSDHFLTNLELTFNLRHESAKADLLRSQSMND
SEGDNCKLRRRKLSSESEGGRENSTNDPEDSADTIRHYQSSKRHFEEKKSRSSSFISSID
DEQKPLFSGIVDSSPGIGKASGLDFEETVPTSGRMHIDKRSHSCKDITDMRSWERENAHP
QPEDSSSSAQQRAAWGISETESDLTYGEVEQRLDLLQEQLNRLESQMTTDIQTILQLLQK
QTTVVPPAYSMVTAGAEYQRPIIRLMRTSQPLASIKTDRSFSPSSQCPEFLDLEKSKLKS
KESLSSGVHLNTASEDNLTSLLKQDSDLSLELHLRQRKTYLHPIRHPSLPESSLSTVGIL
GLHRHVSDPGLPGK
Download sequence
Identical sequences F7IID5
ENSCJAP00000011055 ENSCJAP00000011055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]