SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011486 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011486
Domain Number 1 Region: 178-264
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.45e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00085
Further Details:      
 
Domain Number 2 Region: 440-510
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000177
Further Details:      
 
Domain Number 3 Region: 66-142
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.11e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011486   Gene: ENSCJAG00000006217   Transcript: ENSCJAT00000012117
Sequence length 524
Comment pep:novel chromosome:C_jacchus3.2.1:10:50540249:50654094:-1 gene:ENSCJAG00000006217 transcript:ENSCJAT00000012117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNKRENLLPVAAAGTANMMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTN
TGEDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQ
GTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPS
DPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGINLQERVVTV
SGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAA
AAAGLLGHANLAGVAAFPAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATG
ALAAAAASANPAAAAANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAAS
PLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEF
VPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG
Download sequence
Identical sequences F7IKG0
ENSCJAP00000011486 ENSGGOP00000016093 ENSGGOP00000016093 ENSCJAP00000011492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]