SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012221 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012221
Domain Number 1 Region: 131-251
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.8e-30
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012221   Gene: ENSCJAG00000006580   Transcript: ENSCJAT00000012889
Sequence length 418
Comment pep:novel chromosome:C_jacchus3.2.1:7:66239401:66268533:1 gene:ENSCJAG00000006580 transcript:ENSCJAT00000012889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPPLLPPSATGPDATVGGPAPTP
LLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENY
LDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRD
KAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQ
EQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITR
GATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEG
YYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYREHPYGRY
Download sequence
Identical sequences F7GT83
ENSCJAP00000012221 ENSCJAP00000012224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]