SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012872 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012872
Domain Number 1 Region: 59-133
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000393
Family HLH, helix-loop-helix DNA-binding domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012872   Gene: ENSCJAG00000006943   Transcript: ENSCJAT00000013565
Sequence length 134
Comment pep:novel chromosome:C_jacchus3.2.1:2:61881544:61887138:1 gene:ENSCJAG00000006943 transcript:ENSCJAT00000013565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQDPILSGIGRS
VHNELEKRRRAQLKRCLERLKQQMPLGADCARYTTLSLLRRARMHIQKLEEQEQRARQLK
ERLRSKQQSLQRQL
Download sequence
Identical sequences F6TVR7
ENSCJAP00000012872 ENSCJAP00000012872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]