SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013532 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013532
Domain Number 1 Region: 112-181
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000126
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013532   Gene: ENSCJAG00000032633   Transcript: ENSCJAT00000014254
Sequence length 189
Comment pep:known chromosome:C_jacchus3.2.1:14:90788664:90789233:-1 gene:ENSCJAG00000032633 transcript:ENSCJAT00000014254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNLHETFLSLEDGLGSSDSPGLLSSWDWKDRAGPFELTQASPSQSLSPAPSLESYSSTV
AGLPCEHGGASSGGSDGCSVGGTRGLVEVDYNMLAFQPAYLQGGGGPKAQKGTKVRMSVQ
RRRKASEREKLRMRTLADALHTLRNYLPPIYSQRGQPLTKIQTLKYTIKYIGELTDLLNR
GREPRAQSA
Download sequence
Identical sequences F6ZG01
ENSCJAP00000013532 XP_017819535.1.60252 ENSCJAP00000013532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]