SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013691 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013691
Domain Number 1 Region: 17-178,218-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.49e-68
Family BAR domain 0.00064
Further Details:      
 
Domain Number 2 Region: 272-304,335-392
Classification Level Classification E-value
Superfamily SH3-domain 3.82e-18
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013691   Gene: ENSCJAG00000007335   Transcript: ENSCJAT00000014421
Sequence length 393
Comment pep:known chromosome:C_jacchus3.2.1:7:122590005:122633975:1 gene:ENSCJAG00000007335 transcript:ENSCJAT00000014421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQT
EVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGE
TQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAK
AAETRNSNIPFYVSEYQPQNKLISSSISDIIWAEEVTKSEQELRITQSEFDRQAEITRLL
LEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSLTPVP
SVLPNAIGSSAMASTSGLAITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVI
TVFSVVGMDSDWLMGERGNQKGKVPITYLELLN
Download sequence
Identical sequences F7BKI7
ENSCJAP00000051436 ENSCJAP00000013691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]