SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014243 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014243
Domain Number 1 Region: 94-180
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.38e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 2 Region: 278-353
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000494
Further Details:      
 
Domain Number 3 Region: 8-82
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000555
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014243   Gene: ENSCJAG00000007694   Transcript: ENSCJAT00000015008
Sequence length 362
Comment pep:known chromosome:C_jacchus3.2.1:11:20833825:20837356:-1 gene:ENSCJAG00000007694 transcript:ENSCJAT00000015008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTGVIEGGLNVTLTILLLMHGKEVGSIIGKKGESVKKMHRESGARNNISEKNCPERIIT
LAGPTNAILKAFAMIIDKQEEDISSSMTNSTAANRPPVTLRLVVPASQCGSLIGKGGCKI
KEIRESTGAQVQVAGDMLPNSTERAITIAGILQSIIECVKQICVVMLEPPSKGVTIPHRP
KPSSSPVIFAGGQDRYSTGSDSVSFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLT
KLHQLAMQQSHFPMTHGNTRFSGIESSSPELKGYWAGLDASAQTTSHELTIPNDLIGCRI
GHQGTKINEIHQMSGTQIKTANPVEGSTDRQVTITGSAASISLAQYLINVRLSSETGGMG
SS
Download sequence
Identical sequences F7HQN1
ENSCJAP00000014243 ENSCJAP00000014243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]