SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014385 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014385
Domain Number 1 Region: 105-182
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.49e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014385   Gene: ENSCJAG00000007766   Transcript: ENSCJAT00000015159
Sequence length 206
Comment pep:known chromosome:C_jacchus3.2.1:16:24097200:24098956:-1 gene:ENSCJAG00000007766 transcript:ENSCJAT00000015159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGSVSDSEDMELRGLQREYPVPASKRPPLRSVERSYASPSDNSSAEEEDPDGEEERCA
LGAAGGAGGCKRKRPRVAGGGGAGGGAGGGGKKPLPAKGSAAECKQSQRNAANARERARM
RVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTW
PFVVSGRPDSDTKEVSAANRLCGTTA
Download sequence
Identical sequences F7I9D7
XP_002759034.3.60252 ENSCJAP00000014385 ENSCJAP00000014385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]