SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014709 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014709
Domain Number 1 Region: 360-504
Classification Level Classification E-value
Superfamily CBS-domain pair 3.4e-17
Family CBS-domain pair 0.0068
Further Details:      
 
Domain Number 2 Region: 579-629,677-718
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000157
Family cAMP-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014709   Gene: ENSCJAG00000007949   Transcript: ENSCJAT00000015518
Sequence length 775
Comment pep:novel chromosome:C_jacchus3.2.1:14:1379945:1403144:1 gene:ENSCJAG00000007949 transcript:ENSCJAT00000015518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAPRGGASNANEGRARATLLLAAPVLLVLLWARGARGQSSPQQGAIVGMRLASCNKSCGT
NPDGIIFVSEGSTVNLRLYGYSLGNISSSLISFTEVDDAETGPKSTNCLELTKDLVVQQL
VNVSRGNTSGVLVVLTKFLRRSENMKLYALCTRAQPDGPWLKWTDKDSLLFMVEEPGRFL
PLWLHILLITVLLVLSGIFSGLNLGLMALDPMELRIVQNCGTEKERRYARKIEPIRRKGN
YLLCSLLLGNVLVNTSLTILLDNLIGSGLMAVASSTIGIVIFGEILPQALCSRHGLAVGA
NTIVLTKFFMLLTFPLSFPISKLLDFFLGQEIRTVYNREKLMEMLKVTEPYNDLVKEELN
MIQGALELRTKTVEDIMTQLQDCFMIRSDAILDFNTMSEIMESGYTRIPVFEDEQSNIVD
ILYIKDLAFVDPDDCTPLKTITRFYNHPVHFVFHDTKLDAMLEEFKKGKSHLAIVQKVNN
EGEGDPFYEVLGLVTLEDVIEEIIKSEILDESDMYTDNRSRKRVSEKNKRDFSAFKDADN
ELKVKISPQLLLAAHRFLATEVPQFSPSLISEKILLRLLKYPDVIQELKFDEHNKYYARH
YLYTRNKPADYFILILQGKVEVEAGKENMKFETGAFSYYGTMALTSVPSDRSPAHPTPLS
RSASLSYPDRTDISTASTLAGSSNQFGSALLGQYISDFSVRALVDLQYIKITRQQYQNGL
LASRMENSPQFPIDGCTAHMENLVEKSELPVVDETTTLLNERNSLLHKASHESAI
Download sequence
Identical sequences F7I1N7
ENSCJAP00000014709 ENSCJAP00000047325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]