SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014725 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014725
Domain Number 1 Region: 12-121
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000152
Family CBS-domain pair 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000014725
Domain Number - Region: 217-266,297-324
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000107
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014725   Gene: ENSCJAG00000007962   Transcript: ENSCJAT00000015534
Sequence length 381
Comment pep:novel chromosome:C_jacchus3.2.1:14:1410249:1427031:1 gene:ENSCJAG00000007962 transcript:ENSCJAT00000015534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDASTVLDFGVLASIMQSGHTRIPVYEEERSNIVDMLYLKDLAFVDPEDCTPLSTITRF
YNHPLHFVFNDTKLDAVLEEFKRGKSHLAIVQKVNNEGEGHPFYEVLGLVTLEDVIEEII
RSEILTNSEDYRDTVVRRKPASLMAPLKRKEEFSLFKVSDDEYKVKISPQLLLATQRFLS
REVDVFSPLRISEKVLLHLLKHPSVNQEVRFDDSNRLATHHYLYQRSQPVDYFILILQGR
VEVEIGKEGLKFENGAFTYYGVSALTVPSSVHQSPVSSLQPIRHDLQPEPDGMRSSTYCP
DYTVRALSDLQLIKVTRLQYLNALLATRAQNLPQSPENTDLQVIPGSQTRLLGEKTAIAA
GSSHSRPGIPVEGSPGRNPGV
Download sequence
Identical sequences F7INC1
ENSCJAP00000014725 ENSCJAP00000014725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]