SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014765 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014765
Domain Number 1 Region: 552-623
Classification Level Classification E-value
Superfamily RING/U-box 3.95e-18
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000014765
Domain Number - Region: 650-731
Classification Level Classification E-value
Superfamily Uracil-DNA glycosylase-like 0.0981
Family Mug-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014765   Gene: ENSCJAG00000007986   Transcript: ENSCJAT00000015580
Sequence length 740
Comment pep:known chromosome:C_jacchus3.2.1:15:74461016:74469101:-1 gene:ENSCJAG00000007986 transcript:ENSCJAT00000015580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFNLRPPSPLLVRVSESGPRVRRKLESYFQSQRHSDGGECNVRPREHAAPGTFQVEFSE
RAAKERVLKKGEHQMLVDDKPMPILLVLTENSIKKNTRPQISSLPQSQAETLSGDTHQNE
GRTSKAVDSCLQKIFLTVTADLNCNLFSKEQRAYITTLCPNVKKMEGPNGIEKVYGDFQD
IEKIHQFLSEQFLESEWKQEFSPTVTERKPLSQQDRDSCSSPSEPKTKAEEKSNCFEVPL
PYFEYFKFICPDKINSIKIKFGVNIKIQESSPNMVCLDFTTDQSDDLEAARESFASEFQK
NTEPLKQECVSLADSKQANQIKQKLNHLFTKLLIKEKGRELTLLGTQDDISAAKQKISEV
LVKAPVKLLTASWMTNGIEVDSARYKLLEAELLQEITEIEKRYDTCIKVFEKGQKTCILF
EPKDKQVDLSVHAYASFIDAFQHASCQLMREVLLLKSLGKERKHLHQTEFADDFRKRHPN
VHFVLNKESMTLIGLPNHLAEVKQYVLRGGGTASLSGEKLNEDRVTPMDIDSDDSKAASL
PLKGSVSSEAFEVDKKENGFCVICMDTISNKKVLPKCKHEFCTPCIDKAMEYKPICPTCQ
TSYGVQKGNQPDGSMVVRVSRESLPGYDSCGTIEINYNMKGGKQTKEHPNPGKIYPGVHR
TAYLPDNKEGRKVLELLRRAFEQKLIFTVGNSRALGISDVITWNDIHHKTSKFGGPERYG
YPDPSYLKRVQEELKAKGIE
Download sequence
Identical sequences F7IIM9
XP_002758781.1.60252 ENSCJAP00000014765 ENSCJAP00000014765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]