SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014860 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014860
Domain Number 1 Region: 165-233
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.11e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 76-143
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000131
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 3 Region: 518-567
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000123
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014860   Gene: ENSCJAG00000008043   Transcript: ENSCJAT00000015679
Sequence length 572
Comment pep:novel chromosome:C_jacchus3.2.1:6:24036844:24040060:1 gene:ENSCJAG00000008043 transcript:ENSCJAT00000015679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSLFADLERNGSGGGGGGGGGGGGSGGGGGETLDDQRALQLALDQLSLLGLDSDEGAS
LYDSEPRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVV
TGRKEDVAMARREIISAAEHFSMIRASRNKNTALNGAVPGPPNLPGQTTIQVRVPYRVVG
LVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEAHIALRTGGII
ELTDENDFHANGTDVGFDLHHGSGGSGPGSLWSKPTPSITPTPGRKPFSSYRNDSSSSLG
SASTDSYFGGGTSGSTAATPRLADYSPPSPALSFAHNGNNNGNGYTYAAEASVPSPDGCP
ELQPTFDPAPAPPPGAPLLWAQFERSPGGGPAAPVSSSCSSSASSSASSSSVVFPGAGAS
APSNANLGLLVHRRLHPGTSCPRLSPPLHMAPGAGEHHLARRVRSDPGGGGLAYAAYANG
LGAQLPGLQPSDTSGSSSSSSSSSSSSSSSSGLRRKGSRDCSVCFESEVIAALVPCGHNL
FCMECANRICEKSEPECPVCHTAVTQAIRIFS
Download sequence
Identical sequences F7E2X0
ENSCJAP00000014865 ENSCJAP00000047779 ENSCJAP00000014860 XP_002749237.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]