SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015297 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015297
Domain Number 1 Region: 14-176
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.63e-49
Family G proteins 0.0000000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015297   Gene: ENSCJAG00000008278   Transcript: ENSCJAT00000016149
Sequence length 179
Comment pep:novel chromosome:C_jacchus3.2.1:7:16447930:16476472:1 gene:ENSCJAG00000008278 transcript:ENSCJAT00000016149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNT
HFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAV
LIFANKQDMKGCMTAAEISKYLTVSSIKDHPWHIPSCCALTGEGLCQGLEWMTSRIGVR
Download sequence
Identical sequences F7FF11
ENSCJAP00000015297 ENSCJAP00000015297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]