SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015533 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015533
Domain Number 1 Region: 355-546
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.19e-50
Family cAMP-binding domain 0.0000000291
Further Details:      
 
Domain Number 2 Region: 88-358
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.16e-36
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015533   Gene: ENSCJAG00000008422   Transcript: ENSCJAT00000016410
Sequence length 775
Comment pep:novel chromosome:C_jacchus3.2.1:18:9305883:9317023:1 gene:ENSCJAG00000008422 transcript:ENSCJAT00000016410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEQGPAAAGASEGATPGLEAVPPAAPPPATATSGPIPGSGPEPKRRHLGTLLQPTVNK
FSLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFK
EENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGAEILLAPEAIRTRYLRTWFLVDLIS
SIPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFH
MTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINHMVNHSWGRQYS
HALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQ
YQEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFEEESILGELSEPLREEIINFTC
RGLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLARG
AQDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETV
AMDRLRRIGKKNSILQRKRSEPSPGSSGGIMEQHLVQHDRDMARGVRGLAPSTGARLSGK
PVLWEPLVHVPLQAAAVTSNVAIALTHQRGPLPLSPDSPAILLARSARRSAGSPASPLVP
VRAGPWASTSRLPAPPARTLHASLSRAGRSQVSLLGPPPGGGGRRLGPRGRPLSASQPSL
PQRATGDGSPGRKGSGSERLPPSGLLAKPPRTAQPPRPPVPEPATPGGPQLSANM
Download sequence
Identical sequences F7ELT8
ENSCJAP00000015531 ENSCJAP00000015533 XP_002760136.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]