SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015702 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015702
Domain Number 1 Region: 973-1250
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 8.89e-53
Family Patatin 0.049
Further Details:      
 
Domain Number 2 Region: 189-327
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.98e-24
Family cAMP-binding domain 0.013
Further Details:      
 
Domain Number 3 Region: 639-757
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.95e-22
Family cAMP-binding domain 0.009
Further Details:      
 
Domain Number 4 Region: 522-641
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-19
Family cAMP-binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015702   Gene: ENSCJAG00000037780   Transcript: ENSCJAT00000016590
Sequence length 1375
Comment pep:novel chromosome:C_jacchus3.2.1:22:7278664:7307085:1 gene:ENSCJAG00000037780 transcript:ENSCJAT00000016590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPLQTGMMGLSSHELITNSSGAKVTERDGVQDVPAPVEGRAGRICCPQPVPFVPQVLG
VMIGAGVAVVVTAVLILLVVRRLRVPKTPAPDGPRYRFRKRDKVLFYGRKIMRKVSQSTS
SLVDTSVSTTSRPRMKKKLKMLNIAKKILRIQKETPTLQRKEPPPAVLEADLTEGDLTNS
HLPSEVLYMLKNVRVLGHFEKPLFLELCRHMVFQRLGQGDYVFRPGQPDASIYVVQDGLL
ELCLPGPDGKECVVKEVVPGDSVNSLLSILDVITGHQHPQRTVSARAARDSTVLRLPVEA
FSAVFTKYPESLVRVVQIIMVRLQRVTFLALHNYLGLTNELFSHEIQPLRLFPSPGLPTR
TSPVRGSKRMVSTSATDEPRETPGRPPDPTGAPLPGPTGDPVKPTSLETPSAPLLSRCIS
MPGDISGLQGGPRSDFDMAYERGRISVSLQEEASGGSQTAPARTPTQEPREQPAGACEYS
YCEDESATGGCPFGPYQGRQTSSIFEAAKRELAKLMRIEDPSLLNSRVLLHHAKAGTIIA
RQGDQDVSLHFVLWGCLHVYQRMIDKAEDVCLFVAQPGELVGQLAVLTGEPLIFTLRAQR
DCTFLRISKSDFYEIMRAQPSVVLSAAHTVAARMSPFVRQMDFAIDWTAVEAGRALYRQG
DRSDCTYIVLNGRLRSVIQRGSGKKELVGEYGRGDLIGVVEALTRQPRATTVHAVRDTEL
AKLPEGTLGHIKRRYPQVVTRLIHLLSQKILGNLQQLQGPFPARGLDVPPHSLIRQPSLV
PRQWWEAPPVCSKPWGALTVEVATPHWRTSGRGVKGMVLGLGLGGQFFLVIFGYRKRGGV
PSQEDAHRIVLYQTDASLTPWTVRCLRQADCILIVGLGDQEPTLGQLEQMLENTAVRALK
QLVLLHREEGAGPTRTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAKLHELYEKVFSRRAD
RHSDFSRLARVLTGNTIALVLGGGGARGCSHIGVLKALEEAGVPVDLVGGTSIGSFIGAL
YAEERSASRTKQRAREWAKSMTSVLEPVLDLTYPVTSMFTGSAFNRSIHRVFQDKQIEDL
WLPYFNVTTDITASAMRVHKDGSLWRYVRASMTLSGYLPPLCDPKDGHLLMDGGYINNLP
GKADIARSMGAKTVIAIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWADKVKVPDMAEIQ
SRLAYVSCVRQLEVVKSSSYCEYLRPPIDCFKTMDFGKFDQIYDVGYQYGKAVFGGWSRG
NVIEKMLTDRRSADLNESRRADVLAFPSSGFTDLAEIVSRIEPPTSYVSDGCADGEESDC
LTEYEEDAGPDCSRDEGGSPEGASPSTASEMEEEKSILRHRRCLPQEPPGSATDA
Download sequence
Identical sequences F7EZN5
ENSCJAP00000015702 ENSCJAP00000015702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]