SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015742 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015742
Domain Number 1 Region: 188-227
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000652
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015742   Gene: ENSCJAG00000008540   Transcript: ENSCJAT00000016633
Sequence length 232
Comment pep:known chromosome:C_jacchus3.2.1:8:25382012:25472029:-1 gene:ENSCJAG00000008540 transcript:ENSCJAT00000016633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANGGTRAYSGSDMPSSSSGGANGTAGGGGDGARAAAAGRFPAQVPGAHQPSASGGAAAAS
AAPVAPAPRSRSLGGAVGSVASGARAAQSSFSIPNSSSGPYGSQDSVHSSPEDGGGGRDR
PAGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVPSDEMDLHLVMCLTKPRITYNED
VLSKDAGECAICLEELQQGDTIARLPCLCIYHKGCIDEWFEVNRSCPEHPSD
Download sequence
Identical sequences F7E841
ENSCJAP00000015742 ENSCJAP00000015742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]