SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000016352 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000016352
Domain Number 1 Region: 122-251
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000705
Family cAMP-binding domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000016352   Gene: ENSCJAG00000008939   Transcript: ENSCJAT00000017296
Sequence length 364
Comment pep:novel chromosome:C_jacchus3.2.1:15:77232008:77251751:1 gene:ENSCJAG00000008939 transcript:ENSCJAT00000017296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSANSSTVGQLLLQGSACISWKQDVEGAVYHLANCLLLLGFMGGSGVYGCFYLFGFLSAG
YLCCVLWGWFSACGLDIVLWSFLLALVSLLQLAHLVYRLREDTLPEEFDLLYKALYLPLQ
VPLQTYKEIVHCCEEQVLTLATEQTYAMEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY
QFMDSPEWESLQPSEDGVFQVTLTAETSCSYISWPRKSLHLLLTKERYISCLFSALLGYD
ISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLGPIAADAGPESEKGDEEVCEPSVSPPQAT
PTSLQQTPPCSPPPAATSLPAPPSRARMSRPDSGILASRIPLQSCSQVISRGQAPLAPTH
TPEL
Download sequence
Identical sequences F7B755
XP_002758820.1.60252 ENSCJAP00000016355 ENSCJAP00000016352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]