SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000016694 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000016694
Domain Number 1 Region: 11-120
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-21
Family PDZ domain 0.0000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000016694   Gene: ENSCJAG00000009114   Transcript: ENSCJAT00000017648
Sequence length 259
Comment pep:known chromosome:C_jacchus3.2.1:12:20785036:20802243:-1 gene:ENSCJAG00000009114 transcript:ENSCJAT00000017648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKASRKNKKEGGVSIKVKTSVHDLSKTQQTKLTVGRLGLGLIIIQHGPYLQITHLIRKG
AAANDGKLQPGDVLISVGHANVLGYTLREFLQLLQHITIGTVLQIKVYRDFIDIPEEWQE
IYDLIPEAKFPVTSTPKKTELSKDESFTSSDDNEDGVLDKRLQYYRYPWSTPLYPARRPI
SISRDWHRYNNKNHIISVGKDINCDVMIHRDYQKEVRAPSPYWIMVKQDNESSSSSTSST
SDAFWLEDCAQVEKGKAQL
Download sequence
Identical sequences F6V230
ENSCJAP00000016694 ENSCJAP00000016694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]