SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000017214 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000017214
Domain Number 1 Region: 535-626
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 4.32e-41
Family Small-conductance potassium channel 0.00000363
Further Details:      
 
Domain Number 2 Region: 404-576
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.29e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000017214
Domain Number - Region: 31-103
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000167
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000017214   Gene: ENSCJAG00000009390   Transcript: ENSCJAT00000018207
Sequence length 722
Comment pep:novel chromosome:C_jacchus3.2.1:18:8669698:8830292:-1 gene:ENSCJAG00000009390 transcript:ENSCJAT00000018207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQPPPPPPAPPAAPQQPPGPSLQP
QPPQLQQQQQQQPPHPLSQLAQLQSQPVHPGLLHSSPTAFRAPPSSNSTAILHPSSRQGS
QLNLNDLLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKYSGGVMKPL
SRLSASRRNLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNAHNHQHAGTT
ASSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGLY
SKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLE
MLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLF
TDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQD
VTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELT
KAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIH
QLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTAS
FNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPVSDSPIGVSSTSFPTPYTSSS
SC
Download sequence
Identical sequences F7I0V2
ENSCJAP00000017214 XP_002760092.1.60252 ENSCJAP00000017218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]