SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018339 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018339
Domain Number 1 Region: 272-330
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000537
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018339   Gene: ENSCJAG00000009980   Transcript: ENSCJAT00000019374
Sequence length 375
Comment pep:novel chromosome:C_jacchus3.2.1:5:56870854:56884551:-1 gene:ENSCJAG00000009980 transcript:ENSCJAT00000019374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFQELRMMLLSEAGARKTPGGGDGARARADGAAKEGASAGAVGPEAASEARAKPAVRVRL
EDRFNSIPAEPPPAPRGPEPPEPGVALNNLVTLIRHPSDLMTVPLHQQQNKCTTSVKNKP
AASATALQFTCPLFTANACSASGNSNLSQTQSSSNSCSVLEAAKHQDVGLPRAFSFCYQQ
EMESTKQTLGSRNKALPEQVWIKVGEEALCKQALNKRNRSRMRQLDTNVERRALGEIQNV
GEGTAAMQGTWQSSESSQSNLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRICCDELNL
LVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPDSLVTC
PAQDSLQSSPPMEIK
Download sequence
Identical sequences F7ECS6
ENSCJAP00000018339 ENSCJAP00000018339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]