SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019034 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019034
Domain Number 1 Region: 31-171,203-265,336-342
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.47e-53
Family BAR domain 0.0000097
Further Details:      
 
Domain Number 2 Region: 513-590
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-19
Family SH3-domain 0.00000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019034   Gene: ENSCJAG00000010218   Transcript: ENSCJAT00000020105
Sequence length 591
Comment pep:known chromosome:C_jacchus3.2.1:6:32237858:32274639:1 gene:ENSCJAG00000010218 transcript:ENSCJAT00000020105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGMADETKDEQFEQCVQNFNKQLTEGTR
LQKDLRTYLASVKAMHEASKKLNECLQVYEPDWPGRDANKIAENNDVLWMDYHQKLVDQT
LLTMDTYLGQFLDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEKAA
PQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTF
QSIAGLEENFHKEMSKLNQNLNDVLVSLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDG
SPAATPEIRVNHEPEPAGGSMPGAALPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLF
EDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLWEP
TESPAGSLPSREPSAAEGTFAVAWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAA
SEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLK
AGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
Download sequence
Identical sequences F6RYJ3
ENSCJAP00000019034 ENSCJAP00000019110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]