SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019414 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019414
Domain Number 1 Region: 60-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000887
Family HLH, helix-loop-helix DNA-binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019414   Gene: ENSCJAG00000010516   Transcript: ENSCJAT00000020507
Sequence length 390
Comment pep:novel chromosome:C_jacchus3.2.1:1:179812007:179818034:-1 gene:ENSCJAG00000010516 transcript:ENSCJAT00000020507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWCSEPDPEVSGVPTVGGCNGSSLSGALSCCEDLAQGSRPPKAPLVTVGPSPFLPRNV
ISERERRKRISLSCERLRALLPQFDGRREDMASVLEMSVQFLRLVSTLGPGQERHAVSCK
EMWPSLQENVLQLTLSSQIPAGVPDTGAGASGGARTPDSKVLLENPRPRDLASAPRPVGP
EPLPHILASSRQWDPPSCLALGTDEREALSGLCHVQGGPPSFPEPSSPVPWPPGLSLPKA
ERPPLPWPPFLQQLTSPVSSSEASGWLGQAGSLAVEAASLGEPADEAPMPVQEAGCVLGS
DVEDGTSFLLTAAGPSSWQWSRKGIGGSGPVWAPSDSSPLEEGEPGFLGDPEPGSQELHH
SPLEPWGLDVSSAGLALKDEVDSLFPFFAC
Download sequence
Identical sequences F6U1G2
ENSCJAP00000019414 ENSCJAP00000019414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]