SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019484 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019484
Domain Number 1 Region: 267-371
Classification Level Classification E-value
Superfamily Second domain of FERM 4.97e-28
Family Second domain of FERM 0.002
Further Details:      
 
Domain Number 2 Region: 401-498
Classification Level Classification E-value
Superfamily PH domain-like 5.29e-22
Family Third domain of FERM 0.0052
Further Details:      
 
Domain Number 3 Region: 42-138
Classification Level Classification E-value
Superfamily PDZ domain-like 4.79e-16
Family PDZ domain 0.023
Further Details:      
 
Domain Number 4 Region: 180-261
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000241
Family Ras-binding domain, RBD 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019484   Gene: ENSCJAG00000010556   Transcript: ENSCJAT00000020586
Sequence length 1563
Comment pep:novel chromosome:C_jacchus3.2.1:1:139628013:139690219:1 gene:ENSCJAG00000010556 transcript:ENSCJAT00000020586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELETSLFQTRKAHRIEQMVARWLRRSRDSSGRAKVAAADGPPRNPAQTLIPVRHTVKI
DKDALLQDYGFHISESLPLTVVAVTAGGSAHGKLFPGDQILQMNNEPAEDLSWERAVDIL
REAEDSLSITVVRCTSGVPKSSFLTEEKRARLKTNPVKVHFAEEVLISGHSQGNSLLCMP
NVLKLYLENGQTKAFKFEANTTVKDIILTVKEKLSIRSIEYFALALEEQYSISRLHLLHE
EELIQQVVEREESHDYRCLFRVCFVPKDPLDLLKEDPVAFEYLYLQSCSDVLQERFAVEM
KCSSALRLAALHIQERIYACAQPQKISLKYIEKDWGIENFISPTLLRNMKGKDIKKAISF
HMKRNQNLLEPRQKKKLAVGEATNYIELVQGVKCIFTSLLMLQDRESYIALLVGAKYGIS
QIINSKLNIMSTLAEFASISRVELKEESEKVGMVKVYLQDVKVLTLLLESNSAKDLACLI
AGYYRLLVDPVTSIFLWPGNKQVHRVSAEEGYESRPCSDSEESSEVDCVLEPLSDRRLVK
LGPCRSLIKEEQPTGNSPTPEVARRGPSTCGASSMTDSAESEASDSANTESRGYRTSGSS
ESMDALEEDDLDACSSSRSAFFHLGSPGLPESIDSDSQEERSRTETSGFLCLLDLAQKAN
PQCQKTEFSESAALETFGWAPELSTVRLDPRLYEGSHADYYSLCSSISPGSHLSDSSEST
ASRQGGAPPAWGQQGWTEAQSSSMLESLALHPPLAFEDGSSDEEYYDAADKLTPPGPPSG
PRAVSAAEPSATSLQNKASACSPENSLPSGLDGRETSRRGGVKKYAKTLRKRRSFLQTDY
TSQVSFPLVPSASLESVDGVCYYDREPYLALGAPSPTVSSLQDMQGEPGLLETKALGLLA
PLRETKSSNPASRVMEMEPETMETKSVIDSRVSSISAIRFRIDPNSKENSGVVPVASSSA
STPHCSNPGSSGPDTAQASPSQILSPSQDPDSTDPKELAIEHGDSSSSLSSCDRNPDRVC
LAINPGLLNVSQGDTLELGQVQLEMGLESVCTNHIQETAPKYKEPLLSPGDEPRSDECGI
NPGEKIASIPTKEEQQGQLSLERDREVTNKNGSDRFQEESRKDSGDSLADVSNNISQTLD
VSSPAGKIVTSFSLDAPVTGTEQIPPHPPRDPQGQSRETQGQACQAQEQKLLVELDLDPD
FFLGKQTEGMKVGEIIPNHVTGEDTAPRDTPEWVCFNPTPSLPEPLPCLQEDPHLETSNH
CLLSESKSDSSSICLPADKSFLCFAPESHPEVSAIRMATSLGFAGMNEMVSPRIGMEQCS
CQFSYATCFRGLQPETEEEDRDLETHPTAPLTSPPSAGSPMVLPWRPARAHSCSTAPLSR
KSHIWPEYCSRALRQLKATPASTPEGFIQLMESLLELQDILETSWGIGNKHPPEKCTWYF
TESRSRLCMGSQKLLSSCQHVIRMDQSPEEMQGAVRDTFQHLVQLAGLCFQFTDCSRCST
RHKEAAGNLRDVVYTYHQFVEAAKSTCERGYHDLSVKLLARQCTALTAAVFCLTQKFRAS
TAL
Download sequence
Identical sequences F6SRW1
ENSCJAP00000019484 ENSCJAP00000019484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]