SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019534 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019534
Domain Number 1 Region: 19-109
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 2.93e-28
Family ECR1 N-terminal domain-like 0.00000401
Further Details:      
 
Domain Number 2 Region: 198-275
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.77e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000732
Further Details:      
 
Domain Number 3 Region: 110-194
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.69e-20
Family Cold shock DNA-binding domain-like 0.00000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019534   Gene: ENSCJAG00000010594   Transcript: ENSCJAT00000020643
Sequence length 277
Comment pep:novel chromosome:C_jacchus3.2.1:1:139735764:139740349:-1 gene:ENSCJAG00000010594 transcript:ENSCJAT00000020643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGVSVVAESLAGGGARVARSVLGQVVLPGEELLLPEQEDAEGPGGAGERPLSLNAGAC
SRVRVICGPGLRRCGDRLLVTKCGRLRHKEPGGGGGGGGGVYWVDSQQKRYVPVKGDHVI
GIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEM
VCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIW
VKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Download sequence
Identical sequences F6QXI9
XP_002743149.1.60252 ENSCJAP00000019534 ENSCJAP00000019553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]