SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019690 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019690
Domain Number 1 Region: 8-101
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 2 Region: 774-834
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000628
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 
Domain Number 3 Region: 161-250
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000453
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019690   Gene: ENSCJAG00000010639   Transcript: ENSCJAT00000020810
Sequence length 872
Comment pep:known chromosome:C_jacchus3.2.1:12:65577040:65699661:-1 gene:ENSCJAG00000010639 transcript:ENSCJAT00000020810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPHIKVSGKKEDVKEAKEMIMSVLDTKSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEET
GCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARVRIRELLPLVLMFELPIAGILQPVPD
PNSPSIQHISQTYNISVSFKQRSRMYGATVIVRGSQNNTSAVKEGTAMLLEHLAGSLASA
IPVSTQLDIAAQHHLFMMGRNGSNIKHIMQRTGAQIHFPDPSNPQKKSTVYLQGTIESVC
LARQYLMGCLPLVLMFDMKEEIEVDPQFIAQLMEQLDVFISIKPKPKQPSKSVIVKSVER
NALNMYEARKCLLGLESSGVTIATSPSPASCPAGLACPSLDILASAGLGLTGLGLLGPTT
LSLNTSTTPNSLLNALNSSVSPLQSPSSGTPSPTLWAPPLANTSSATGFSAIPHLMIPST
AQATLTNILLSGVPTYGHTAPSPPPGLTPVDVHINSMQTEGKKISAALNGHAQSPNIKYG
AISTSSLGEKVLSANHGDPSIQTSGSEQASPKSSPTEGCNDAFVEVGMPRSPSHSGNAGD
LKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAA
ERAAAAQQNSERAHLAPRSSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLG
FSKSMPAETIKELRRANHVSYKPTMTTTYEGSSMSLSRSNSREHLGSGSESDNWRDRNGI
GPTSHSDFAASIGSPKRKQNKSTEHYLSSSNYMDCISSLTGSNGCNLNSSFKGSDLPELF
SKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISELNKNRRRLFE
SPNARTSFLEGGASGRLPRQYHSDVASVSGRW
Download sequence
Identical sequences F6SFQ4
ENSCJAP00000019690 ENSCJAP00000019690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]