SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020330 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020330
Domain Number 1 Region: 539-730
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.37e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 27-189
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.32e-27
Family FCH domain 0.012
Further Details:      
 
Domain Number 3 Region: 784-841
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-17
Family SH3-domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000020330
Domain Number - Region: 306-375
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000445
Family FCH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020330   Gene: ENSCJAG00000011008   Transcript: ENSCJAT00000021478
Sequence length 981
Comment pep:novel chromosome:C_jacchus3.2.1:X:140443975:140463921:-1 gene:ENSCJAG00000011008 transcript:ENSCJAT00000021478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAHGKLRRERGLQAEYETQVKEMRWQLSEQLRCLELQGELRRELLQELAEFMRRRAEVE
LEYSRGLEKLAERFSSRGGRLGSSREHQSFRKEPCLLSPLHCWAVLLQHTRQQSRESAAL
SEVLAGPLAQRLSHIAEDVGRLVKKSRDLEQQLQDELLEVVSELQTAKKTYKAYHTKNVN
AEGQREAERQEEKSGRSAPTATAAATEAGPLRRTSLKKGGRLVEKMGPVERPMTASSCAP
VCWLQAGFLTHPPWEVLCTPSTHQVSVNMGSMAERCWVNNRGVRSLLALDWAFCGLATQA
CPCFPQCCDTGFHLALGQVLRSYTAAESRAQASQVQGLGSEEAVESLDPPGDKAKVLEVH
AIAFCPPLRFDYQPHDGDEVAELRVEMELRDEILPRAQNIQSRLDQQTIETEEVNKTLKA
TLQALLEVVALDDGDVLDSFQTNPSTESLKSTSSDPGSRQAGRRRGQQQETETFYISKLQ
EYLSGRSILAKLRAKLEKLQEALQRGDKEEREMSWTQYTQRKFQKSRHPRPSSQYNQRLF
GGDMEKFIQSSGQSVPLVVESCIRFINLNGLQHEGIFRVSGPQLRVSEIRDAFERGEDPL
VEGCSAHDLDLVAGVLKLYFRSLEPPLFPPDLFSELLASSELEATAARVEHVSRLLWRLP
APVLVVLRYLFTFLNHLAQYSDENMMDPYNLAVCFGPTLLPVPAGQDPVTLQGRVNQLVQ
TLIMQPDRVFPPLTELPGPIYEKCMAPPSTCCLGDAQLESLGADNEPELEAGTLTQEDDL
EGVVEAVACFAYTGRTAQELSFRRGDMLQLHERASSDWWWGEHEGARGLIPHKYIALPVG
AEKQGVGAGMQTTDDSESSPEGLLASELVHRLEQCTSPEAVGPPGHRRHCLVPACLEQHV
EVDKAVAQNMGSVFKELLGKASARQGLGPAPVTSPSPGSRSPKAPVSSRLGRNKGFSQDP
GAPASLSVSHPQGLDSTPKPH
Download sequence
Identical sequences F6YW11
ENSCJAP00000020330 ENSCJAP00000049675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]