SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020428 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020428
Domain Number 1 Region: 31-282
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.15e-61
Family FCH domain 0.0022
Further Details:      
 
Domain Number 2 Region: 353-409
Classification Level Classification E-value
Superfamily SH3-domain 6.43e-23
Family SH3-domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020428   Gene: ENSCJAG00000011058   Transcript: ENSCJAT00000021583
Sequence length 410
Comment pep:novel chromosome:C_jacchus3.2.1:Y:1528052:1569870:-1 gene:ENSCJAG00000011058 transcript:ENSCJAT00000021583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPQLQFKDAFWVSEFTAHSYEVQLLMQKMCKDMELLRQRAQAEERYGKELVQIARKAGG
QTEINSLRASFDSLKQQMENVGSSHIQLALTLREELRSLEEFRERQKEQRKKYEAVMDRV
QKTKLSLYKKAMESKKTYEQKCRDADDAEQTFERISANGHQKQVEKSQNKAKQCRDSAAE
AERVYRQSIAQLEKVRAEWEQEHRSTCEAFQLQEFDRLTILRNALWVHSNQLSMQCVKDD
ELYEEVRLTLEGCSIDADIDGFIQAKSTGTEPPAPVLYQNYYDREVTPLTGSPSIQPSCG
MIKRFSGLLHGSPKTTSLAASAASTETLTPTPERNEGVYAAIAVQEMQGNSASPAQEYRA
LYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKL
Download sequence
Identical sequences F7EDS7
ENSCJAP00000020428 ENSCJAP00000020443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]