SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020431 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020431
Domain Number 1 Region: 349-501
Classification Level Classification E-value
Superfamily TRAF domain-like 2.62e-46
Family MATH domain 0.0000000247
Further Details:      
 
Domain Number 2 Region: 64-135
Classification Level Classification E-value
Superfamily RING/U-box 1.11e-18
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 186-281
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000981
Family SIAH, seven in absentia homolog 0.02
Further Details:      
 
Domain Number 4 Region: 129-184
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000418
Family SIAH, seven in absentia homolog 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020431   Gene: ENSCJAG00000011070   Transcript: ENSCJAT00000021586
Sequence length 523
Comment pep:known chromosome:C_jacchus3.2.1:11:99778844:99800403:-1 gene:ENSCJAG00000011070 transcript:ENSCJAT00000021586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLNCENSCGSSQSESDCCGAMASSCSAATKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVRCPNEGCLHKMELRHLEDHQVHCEFALMDCPQCQRPFQKCQINIHILK
DCPRRQVSCVNCAASMAFEDKEIHDQNCPLANVVCEYCNTVLIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLTLTPAPPTPEVWNFQETI
HQLEGRLVRQDHQIRELTAKMETQGMYVNELRRTIRTLEDKVAEIEAQQCNGIYIWKIGN
FGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYD
SHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHL
EALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDTGV
Download sequence
Identical sequences A0A2K5DHG0 F7ES31
ENSCJAP00000020431 XP_002755232.1.60252 XP_009006191.1.60252 XP_012307783.1.9421 XP_012307784.1.9421 ENSCJAP00000020431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]