SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020439 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020439
Domain Number 1 Region: 268-352
Classification Level Classification E-value
Superfamily RING/U-box 1.04e-26
Family RING finger domain, C3HC4 0.0000108
Further Details:      
 
Domain Number 2 Region: 354-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000964
Family Classic zinc finger, C2H2 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020439   Gene: ENSCJAG00000011082   Transcript: ENSCJAT00000021595
Sequence length 1043
Comment pep:known chromosome:C_jacchus3.2.1:11:99857897:99869593:1 gene:ENSCJAG00000011082 transcript:ENSCJAT00000021595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASFPPTLGLSSAPDEIQHPHIKFSEWKFKLFRVRSFEKTPEEAQKEKKDSSEGKSSLE
QSPAVLDKADGQKPVQTHPMLKPHPKFSKKFHDDGKARGKAIHQANLRYLCRICGNSFKT
DEHNRRYPVHGPVDGKTLGLLRKKEKRATSWPDLIAKVFRINVKADVDLIHPTEFCHNCW
SVMHRKFSSALGEVYFPRKATVEWHPHTPSCDICNTVRQGLKRKSLQPNLQLSKKLKTVL
NHARQARQRKRRAQARISSKDIMKKTANCSKIHLSTKLLAVDFPEHFVKSISCQICEHIL
ADPVETSCKHVFCRVCIIRCLKVMGSYCPSCRYPCFPTDLESPVKSFLSILNSLMVKCPA
QECNEVVSLEKYNHHISSHKESKETFVHINKGGRPRQHLLSLTRRAQKHRLRELKLQVKA
FADKEEGGDVKSVCMTLFLLALRARNEHRQADELEAIMQGRGSGLQPAVCLAIRVNTFLS
CSQYHKMYRTVKAITGRQIFQPLHALRNAEKVLLPGYHHFEWQPPLKNVSSRTDVGIIDG
LSGLSSSVDDYPVDTIAKRFRYDSALVSALMDMEEDILEGMKSQDLEDYLNGPFTVVVKE
SCDGMGDVSEKHGSGPVVPEKAVRFSFTIMKITIAHNSQNVKVFEEAKPNSELCCKPLCL
MLADESDHETLTAILSPLIAEREAMKSSELMLEMGGILRTFKFIFRGTGYDEKLVREVEG
LEASGSVYICTLCDATRLEASQNLVFHSITRSHAENLERYEVWRSNPYHESVEELRDRVK
GVSAKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKNPNASKEERKRWQATLDKHL
RKKMNLKPIMRMNGNFARKLMTKETVDAVCELIPSEERHEALRELMDLYLKMKPVWRSSC
PAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWA
SEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYTSKYLQKFMNAHNALKTSGFTMN
SQASLGDPSGIEDSLESQDSMEF
Download sequence
Identical sequences F7ERX5
ENSCJAP00000020439 ENSCJAP00000020439 XP_009006192.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]