SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021660 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000021660
Domain Number 1 Region: 886-1076
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.58e-46
Family cAMP-binding domain 0.00015
Further Details:      
 
Domain Number 2 Region: 653-878
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.6e-25
Family Voltage-gated potassium channels 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021660   Gene: ENSCJAG00000011758   Transcript: ENSCJAT00000022895
Sequence length 1234
Comment pep:novel chromosome:C_jacchus3.2.1:20:11929463:12019677:-1 gene:ENSCJAG00000011758 transcript:ENSCJAT00000022895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGWVQRVLPQPPETPRKTKMQEEEKVEPEPVLEAEVEPEPNPEEAETESESMPPEESFK
EEEMAVAHPNPQGDKKAALTSTISVQAQGADSEMTSPSRRVLSWLMKGVEKVVPQPVHSA
REDPAQILGHGSTGDTGCTEEPNKALEAQDTSPPGPRLLLWLERNLERVLPQPPRSSEES
QGREGQGTGVSYDHTSLGHQFKQERRKKKEGKEEKREGNQDSLRSSWDYRRAPPCPANIF
LPTGHSTLSLTYRLVAWVLHRLEMALPQPVLHGKTGEQEPDSPGMCNVQTISILPGGQVE
PDLVLEEVEPHWEGACQDVSTSLQSTEVVPAYEEENKAVEKMPRWGKRIAGGRGEEEEEE
EVVEEEEEERTNLVLLDSCVVSQVGVGQSEEDRTQPQSVSDKDLREEAEEEAEEEAEEEA
EEEKVKEAAKEKAKEEPQNWADTKEEPEATAASSGVPATKERPEVQVEDTDADGHALLVE
ENPPSPLLPLPSPAKSDTLTVPNSASGTHRKKLPSEDDEAEELKALSPAESPVVAWSDPT
TPKNTDSQDRAVSMASTSSAIINDRLQELVKLFKERTEKVKEKLIDPDVTSDEESPKPSP
AKKAPEPAPDTKPVEAEPVEEGHYCNMLCCKFKRRPWKKYQFPQSIDPLTNLMYILWLFF
VVMAWNWNCWLIPVRWAFPYQTPDNIHLWLLTDYLCDLIYFLDITVFQIRLQFVRGGDII
TDKKDMRNNYLKSRRFKMDLLSLLPLDFLYLKVGVNPLLRLPRCLKYMAFFEFNNRLESV
LSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAYQGLGSTHWVYDGVGNSYIRCYYFAVKT
LITIGGLPDPKTLFEIVFQGLNYFTGVFAFSVMIGQMRDVVGAATSGQTYYRSCMDSTVK
YMNFYKIPKSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYNIVSKVAL
FQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKSVLVTL
KAGSVFGEISLLAVGGGNRRTANVVAHGFANLFILDKKDLNEILVHYPESQKLLRKKAKR
MLKNNNRPKEKSVLILPPPAGTPKLFSAALAVTGKMGGKGAKGGKLAHLRARLKELAALE
AAAKQQELLEQAKSSQDAKGEEGSAIPDPSAPRTPLEPPGSPPPASPGRPEGEEERAAGP
EEHSVRIRMSPGPEPGGEQILSVEMPEEEKEKVA
Download sequence
Identical sequences F6RJV0
ENSCJAP00000021649 ENSCJAP00000021660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]