SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022104 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022104
Domain Number 1 Region: 8-219
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.88e-55
Family IMD domain 0.0000685
Further Details:      
 
Domain Number 2 Region: 319-403
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000101
Family SH3-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022104   Gene: ENSCJAG00000012023   Transcript: ENSCJAT00000023369
Sequence length 522
Comment pep:novel chromosome:C_jacchus3.2.1:1:200543993:200566637:-1 gene:ENSCJAG00000012023 transcript:ENSCJAT00000023369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPHLHPFSLLAPAFQSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFNAIQKIGERA
LQSPTSQILGGALITLTLHSTQVQTFHGDLLQHMEKNTKLDMQFIKDSRQHYEIEYRHRA
ANLEKCMSELWRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELEEKRRYRFLAEK
HLLLSNTFLQFFGRARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPALGPPYPSGRLTP
TRLDMPPRPLGEFSSPRSRHSSGSFGPEPDARPASQLEPDRRSLPRTPSASSLYSISTQS
SRSNSFGERPGGGGGGGGARRVRALVSHSEGANHTLLRFSAGDVVEVLVPEAQNGWLYGK
LEGSSASGWFPEAYVKALEEGPMNPMTPMTSMTPMTPMTPMKPMNPVNELPSRSYPLRGS
HSLDDLLDRPGNSTAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRSSMGSTGVATD
VKKLMSSEQYPPQELFPRGTNPFATVKLRPTITNDRSAPLIR
Download sequence
Identical sequences F6YTH5
ENSCJAP00000022104 ENSCJAP00000022104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]