SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022266 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022266
Domain Number 1 Region: 45-129
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.65e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00087
Further Details:      
 
Domain Number 2 Region: 332-400
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.6e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022266   Gene: ENSCJAG00000012121   Transcript: ENSCJAT00000023539
Sequence length 401
Comment pep:known chromosome:C_jacchus3.2.1:22:38012394:38028981:-1 gene:ENSCJAG00000012121 transcript:ENSCJAT00000023539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTTERVCLVQGTAEALNAVHSFIAEKVREIPQAMTKPEVVNILQPQTTMNPDRAKQAKLI
VPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTVSGEPEQVHKAVSAI
VQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASPADVLPAAAAASAAAASGLLGPA
GLAGVGAFPAALPAFSGTDLLAISTALNTLASYGYNTNSLGLGLNSAAASGVLAAVAAGA
NPAAAAAANLLASYAGEAGAGPAGGAAPPPPPPPGALGSFALAAAANGYLGAGAGGGAGG
GGGPLVAAAAAAGAAGGFLTAEKLAAESAKELVEIAVPENLVGAILGKGGKTLVEYQELT
GARIQISKKGEFLPGTRNRRVTITGSPTNTQAAQYLISQRV
Download sequence
Identical sequences F7C8L3
ENSCJAP00000022266 ENSCJAP00000022266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]