SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022668 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022668
Domain Number 1 Region: 308-492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-70
Family SPRY domain 0.0000033
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 5.18e-20
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 92-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.44e-18
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022668   Gene: ENSCJAG00000012363   Transcript: ENSCJAT00000023980
Sequence length 513
Comment pep:known chromosome:C_jacchus3.2.1:4:192616:218348:1 gene:ENSCJAG00000012363 transcript:ENSCJAT00000023980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASASVAECLQQETTCPVCLQYFSEPMMLDCGHNICGACLARCWGAAETNVSCPQCRETF
PQRHLRPNRHLANVTQLVKQLRSERPVGPGGEMGACEKHREPLKLYCEQDQTPICVVCDR
SREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSGLIAQLEEKQ
QQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTEGLKQFTEKMQS
DMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCV
LGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL
TSPMTALPLRTPLQRVGVFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG
GKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP
Download sequence
Identical sequences F7IS92
ENSCJAP00000022668 ENSCJAP00000022668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]