SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022796 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022796
Domain Number 1 Region: 31-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.02e-49
Family G proteins 0.000000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022796   Gene: ENSCJAG00000012441   Transcript: ENSCJAT00000024118
Sequence length 223
Comment pep:known chromosome:C_jacchus3.2.1:X:62223842:62226450:1 gene:ENSCJAG00000012441 transcript:ENSCJAT00000024118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAFGHREAWVGAGDFGLKAAEGPEYQSPCKAKLVFLGDPSWKTSIITRFMYDSFGCTFQ
ATVGIDFLSKNMYLEDRIVQLQLWDTAGQERFHSLIPSYIRGSTIAVVVYDVTNINSFKE
TDKWVERVRAERGDDVVIMLVGNKIDLNNERQVTAEEGEEKSRNLNVMFIETSAKTSYNV
DKLFRCVASALPSTSTSPPPKEGTVEIQLEPFEESGNRNYCSK
Download sequence
Identical sequences F7I3M6
ENSCJAP00000022796 ENSCJAP00000022796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]