SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022938 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022938
Domain Number 1 Region: 962-1132,1171-1312
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 9.34e-49
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.027
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000022938
Domain Number - Region: 660-692
Classification Level Classification E-value
Superfamily RING/U-box 0.00494
Family RING finger domain, C3HC4 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022938   Gene: ENSCJAG00000019414   Transcript: ENSCJAT00000024269
Sequence length 1321
Comment pep:novel chromosome:C_jacchus3.2.1:14:20009088:20055799:-1 gene:ENSCJAG00000019414 transcript:ENSCJAT00000024269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLTLGESWPVLVGKRFLSLSAADGSDDGHDSWDVERVAEWPWLSGTIRAVSHTDVTKKD
LKVCVEFDGESWRKRRWIEVYSLLRRAFLVEHNLVLAERKSPEISERIVQWPAIMYKPLL
DKAGLGSITSIRFLGDQQRVFLSKDLLKPIQDVNNLRLSLTDNQIVSKEFQALIVKHLDE
SHLLKGDKNLVGSEVKIYSLDPSTQWFSATVVNGNPASKTLQVNCEEIPALKIVDPSLIH
VEVVHDNLVTCGNSARIGAVKRKSSESNGTLVSKQAKSCSEASPSMCPVQSVPTTVFKEI
LLGCTAATPPSKDPRQQSTPQAANSPPNLGAKIPQGCHKQSLPEEISSCLNTKSEVLRTK
PDVCKAGLFSKSSQIGTGDLKILSEPKGSCTQPKTNTDQENRLESVPQPLTGLPKECLPT
KTSSKAELEIASTPELQKHLEHAPSTSDVSNTPEVKADVNSDNPNNCSGKKVEPSALACR
SQNLKESSVKVDNESCCTRSNNKIQNAPSRKSVLTDPAKLKKLQQSGEAFVQDDSCVNIV
AQLPKCRECRLDSLRKDKEQQKDSPVFCRFFHFRRLQFNKHGVLRVEGFLTPNKYDSEAI
GLWLPLTKNVVGIDLDTAKYILANIGDHFCQMVISEKEAMSTIEPHRQVAWKRAVKGVRE
MCDVCDTTIFNLHWVCPRCGFGVCVDCYRMKRKNCQQGAAYKTFSWLKCVKSQIHEPENL
MPTQIIPGKALYDVGDIVHSVRAKWGIKANCPCSNRQFKLFSKPSSKEDLKQTSLTGEKP
TLGAVLQQNPSVLEPAAMGGEAPSKPASSMKPACPASTSPLNWLADLTSGNVNKENKEKQ
PTMPVLKNEIKCLPPLPTLSKSSTVLHTFNSTILTPVSNNNSGFLRNLLNSSTGKTENGL
KNTPKILDDIFASLVQNKTSSDVSKRPQGLTIKPSILGFDTPHYWLCDNRLLCLQDPNNK
SNWNVFRECWKQGQPVMVSGVHHKLNSELWKPESFRKEFGEQEVDLVNCRTNEIITGATV
GDFWDGFEDVPNRLKNEKEPMVLKLKDWPPGEDFRDMMPSRFDDLMANIPLPEYTRRDGK
LNLASRLPNYFVRPDLGPKMYNAYGLITPEDRKYGTTNLHLDVSDAANVMVYVGIPKGQC
EEEEEVLKTIQDGDSDELTIKRFIEGKEKPGALWHIYAAKDTEKIREFLKKVSEEQGQEN
PADHDPIHDQSWYLDRALRKRLHQEYGVQGWAIVQFLGDVVFIPAGAPHQVHNLYSCIKV
AEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIYHAVKDAVAMLKASESSFGK
P
Download sequence
Identical sequences F7D9Q3
XP_002757578.1.60252 ENSCJAP00000022938 ENSCJAP00000036125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]