SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023086 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023086
Domain Number 1 Region: 366-449
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-18
Family HLH, helix-loop-helix DNA-binding domain 0.00000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023086   Gene: ENSCJAG00000012620   Transcript: ENSCJAT00000024425
Sequence length 453
Comment pep:novel chromosome:C_jacchus3.2.1:16:66987187:66991816:-1 gene:ENSCJAG00000012620 transcript:ENSCJAT00000024425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDFFRAVENEQAPATMPLNVSFSNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSTSCVSVTPFSPRGDNDGGGGSFSTADQLEMVTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSSSPNPA
RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKPCASPDSSAFSTSSDSLLS
STESSPRASPEPLVLHEETPPTTSSDSEEEQEDEEIDVVSVEKRQPPGKRSESGSPSSGG
HSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPR
SSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATTYILSV
QAEEQKLISEKDLLRKRREQLKHKLEQLRNSCA
Download sequence
Identical sequences F7I481
ENSCJAP00000023086 ENSCJAP00000023101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]