SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023174 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000023174
Domain Number - Region: 57-139
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000214
Family Eukaryotic type KH-domain (KH-domain type I) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023174   Gene: ENSCJAG00000012640   Transcript: ENSCJAT00000024518
Sequence length 896
Comment pep:known chromosome:C_jacchus3.2.1:20:2080855:2156613:-1 gene:ENSCJAG00000012640 transcript:ENSCJAT00000024518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARAVLDEFTAPAEKAELLEQSRGRIEGLFGVSLAVLGALGAEEPLPARIWLQLRGAQE
AVHSAKEYIKGICEPELEERECYPKAMHCIFVGAESLFLKSLIQDTCADLCILDIGLLGI
RGSAEAVVMARSHIQQFVKLFENKENLPSSQKESEVKREFKQFVEAHADNYTMDLLILPT
SLKKELLTLTQGEENLFETGDDDVIEIKDSQQTEFTQNAATGLNISRDETVLQEEARNKV
GTPVSELTQQMDTVLSSSPDVLFDPINGLSPDEEALSHERMCQKRRSSDSEERHTKKQFS
LENVQEGEISHDAKTLAENVIVDLSDSSTNSENLSPDTKDTTEEMEYNILVNFFKTMGYS
QEIVEKVIKEYGPSTEPLLLLEEIEKENKRFQEDREFSASTVYPETNKTKNKGVYSSTNE
LTTDSTPKKTQTHTQQNMVEKFPQLPFRGEAKPCTSNCRINTFRPVPIEQKHEVWGSNQN
YVCNIDPETDGLSPSVASSSPKEVNFVSRGPSSHQPRVPVFPENGLHQQPEPLLPNNMKS
ACEKRLGCCSSPHSKPNCSALSSPMPLPQLLPSVTDARLAGTSDHIDSSVTGVQRFRDTL
KVPYKLELKNEPGRTDLKHIVIDGSNVAITHGLKKFFSCRGIAIAVEYFWKLGNRNITVF
VPQWRTRRDPNVTEQHFLTQLQELGILSLTPARMVFGERIASHDDRFLLHLADKTGGIIV
TNDNFREFVNESVSWREIITKRLLQYTFVGDIFMVPDDPLGRSGPRLEEFLQKEVCLRDM
QPLLNALPNVGMFDPSFRVPGTQAASTSHQPPTRIQGAPSSHWLPQQPHFPLLPTLPNLQ
QNLPMPAQRSSAETSELREALLKIFPDSEQRLKIDQILVAHPYMKDLNALSAMVLD
Download sequence
Identical sequences F7HUS5
ENSCJAP00000023174 XP_002760971.1.60252 ENSCJAP00000023174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]