SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023216 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023216
Domain Number 1 Region: 26-233
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.9e-59
Family BAR domain 0.00000831
Further Details:      
 
Domain Number 2 Region: 620-697
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000214
Family SH3-domain 0.0000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023216   Gene: ENSCJAG00000012658   Transcript: ENSCJAT00000024564
Sequence length 698
Comment pep:novel chromosome:C_jacchus3.2.1:8:6172444:6410475:-1 gene:ENSCJAG00000012658 transcript:ENSCJAT00000024564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQREL
RGYLAAIKALGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSL
LTLDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQK
VFEEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQH
ADKAFSIQGAPSDSGPLRIAKTPSPPEEPSPLPSPTASPNHTLAPASPAPARPRSPSQTR
KGPPVPPLPKVTPTKELQQENIISFFEDNFVPEISVTTPSQNEVPEVKKEETLLDLDFDP
FKPEVTPAGSAGVTHSPMSQTLPWDLWTTSTDLVQPASGGSFDGFTQPQDTSLFKMQTDQ
SMICNLGEREQGTERKVAESLIAIIGIWMMPGIDLGIETKALEPEETLQIIPGADADAAV
GTLVSAAEGAPGEEAEAEKATLPTGEGVNLEEAEIGTETTGSAESAQPESEELEAAVPQE
KVIPSVVIEPASNHEGEGEHEITIGTEPKETTEDAAPLGPTSETPELATEQKPLQDPQPT
PSAPATGAADQLASAKEASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSE
ADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRLD
Download sequence
Identical sequences F7IQC2
ENSCJAP00000023225 ENSCJAP00000023216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]